PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_002305-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family HD-ZIP
Protein Properties Length: 726aa    MW: 80167.5 Da    PI: 5.2545
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_002305-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.82.9e-21108163156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      r+k +++t eq++e+e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  AHYPO_002305-RA 108 RKKYHRHTVEQIREMEALFKESPHPDEKQRQQLSKQLGLHPRQVKFWFQNRRTQIK 163
                      7999************************************************9877 PP

2START126.82.7e-402824353135
                      HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
            START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                        +a++el k+a++++p+W ks+    e++n+de+ ++f  + +       +s+ea+r+s+vv+m+l++lv+ ++d++ qW+e+++    ka++
  AHYPO_002305-RA 282 VDKALEELKKMATLGDPMWIKSVetgrEILNYDEYSKEFLVETSnvsgkhkRSIEASRESRVVFMDLPRLVQCFMDVN-QWKEMFPclisKAAV 374
                      678999********************************96655577********************************.*************** PP

                      EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS CS
            START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqk 135
                      ++vi++g      ga+qlm+aelq+l+p+vp R+++fvR+++ql+ ++w+ivdvSvd+ ++
  AHYPO_002305-RA 375 VDVICNGegpnkdGAIQLMYAELQMLTPMVPtREVYFVRCCKQLSNEQWAIVDVSVDHLED 435
                      *********************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-2294159IPR009057Homeodomain-like
SuperFamilySSF466891.04E-2097166IPR009057Homeodomain-like
PROSITE profilePS5007117.896105165IPR001356Homeobox domain
SMARTSM003894.4E-19107169IPR001356Homeobox domain
PfamPF000461.5E-18108163IPR001356Homeobox domain
CDDcd000861.92E-17112163No hitNo description
PROSITE patternPS000270140163IPR017970Homeobox, conserved site
PROSITE profilePS5084821.884271432IPR002913START domain
SuperFamilySSF559619.06E-21273464No hitNo description
CDDcd088753.67E-72278463No hitNo description
SMARTSM002343.5E-34280464IPR002913START domain
PfamPF018525.1E-31282434IPR002913START domain
SuperFamilySSF559617.55E-13486658No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 726 aa     Download sequence    Send to blast
MGVDMSNNPP NSQFSKDFFS SPALSLSLAG IFRGAEAEAE AAAAAAARVG DVEEGEEGSG  60
GRRDETVDIS SENSGPARSR SEDEFMINAD DDDDDDGAAD DKSKNKKRKK YHRHTVEQIR  120
EMEALFKESP HPDEKQRQQL SKQLGLHPRQ VKFWFQNRRT QIKAIQERHE NSLLKAELEK  180
LKEENKYLRE NTNKTSCPNC GFATIGSRDT AVTTDDHQQL KLENARLKAE VEKLRAVVGK  240
YPAGRVSPTA SCSTSNDQDN RTSLDLYSGP FGIDRTKIME VVDKALEELK KMATLGDPMW  300
IKSVETGREI LNYDEYSKEF LVETSNVSGK HKRSIEASRE SRVVFMDLPR LVQCFMDVNQ  360
WKEMFPCLIS KAAVVDVICN GEGPNKDGAI QLMYAELQML TPMVPTREVY FVRCCKQLSN  420
EQWAIVDVSV DHLEDSIDAS TIVNSGLAFG AKHWMSTLQL QCERLVFFMA TNVPTKDSSG  480
VGTLAGRKSI LKLAHRMTLS FCRALGASTC KTWTKIATKT GEDVRVGTRK NLNDPSEPIG  540
VILCAVSSVW LPVSPNVLFD FLRDDAHRHE WDVMANGSQV QSIASLAKGQ DRGNTVSIQT  600
MKSKDNMTWV LQDSSINTYE SMVVYAPVEI SDMQSVMTGC DSSNVPVLPS GFSILPDGME  660
SRPLVLTSRQ EEKSSEGGSL LTIALQVVSN SSSAAKLTVE SIEPFSSVIS CILGNIKTSL  720
QCEDG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105109KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010691342.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A0J8ECT30.0A0A0J8ECT3_BETVU; Uncharacterized protein
STRINGPOPTR_0003s05100.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein